Protein Info for PGA1_c02770 in Phaeobacter inhibens DSM 17395

Annotation: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase GpmI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01676: Metalloenzyme
  • amino acids 5 to 494 (490 residues), 252.6 bits, E=4.4e-79
• TIGR01307: phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
  • amino acids 5 to 505 (501 residues), 629.8 bits, E=1.5e-193
• PF06415: iPGM_N
  • amino acids 83 to 293 (211 residues), 250.9 bits, E=9.5e-79

Best Hits

Swiss-Prot: 83% identical to GPMI_RUEST: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (gpmI) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 83% identity to sit:TM1040_2757)

Predicted SEED Role

"2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

• gluconeogenesis I (12/13 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• Bifidobacterium shunt (12/15 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• homolactic fermentation (9/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• glycolysis IV (7/10 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• photorespiration II (7/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (5/9 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• glycerol degradation to butanol (9/16 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1

Sequence Analysis Tools

See I7EW26 at UniProt or InterPro

Protein Sequence (506 amino acids)

>PGA1_c02770 2,3-bisphosphoglycerate-independent phosphoglycerate mutase GpmI (Phaeobacter inhibens DSM 17395)
MSTPKPVVLCILDGWGNADPGTANAPYLAQTPTLDEIAKTCPMARLITHGPDVGLPSGQM
GNSEVGHTNIGAGRVVAMDLGQIDLAIDDGSFFDNEALQGFIARLKETGGAAHLMGLVSD
GGVHGHITHILAAVKAIRDAGVPVWLHAMTDGRDVAPKSALDFVTALQGDLAEGARIATV
TGRYYAMDRDNRWERVSQAYDAMIHGRGQYEAETAADAIKASYARDELDEFIKATVIDGY
DGVKDGDGLFCLNFRADRAREILRAMGEPGFDAFDTGTRPKLAALLGMVEYSEGHNGYMQ
TVFPKRAIVNTLGAWVAKQGKRQFRLAETEKYPHVTFFLNGGKEDPEEGEDRAMPQSPKV
ATYDLQPEMSAPEVTERFVEAIEAGYDLIVTNYANPDMVGHTGDLGAAIKACEAVDEGLA
KVVAALKAAGGVMLVTADHGNCEVMVDPDTGGPHTAHTTNLVPVALVGGPAGAQLRDGRL
ADLAPTLLQLMDLPKPDEMTGESLLA