Protein Info for Psest_2701 in Pseudomonas stutzeri RCH2

Annotation: Response regulator containing a CheY-like receiver domain and an HD-GYP domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF00072: Response_reg" amino acids 11 to 121 (111 residues), 76.1 bits, see alignment E=3.7e-25 PF13487: HD_5" amino acids 164 to 330 (167 residues), 123.8 bits, see alignment E=9.3e-40 PF01966: HD" amino acids 175 to 298 (124 residues), 75.4 bits, see alignment E=6.8e-25

Best Hits

KEGG orthology group: K07814, putative two-component system response regulator (inferred from 59% identity to pmk:MDS_1238)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPA2 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Psest_2701 Response regulator containing a CheY-like receiver domain and an HD-GYP domain (Pseudomonas stutzeri RCH2)
MLSDEIRHSTVVVIDDITASLRLLESSVRAIGVQRIMAFSDSAAGLAWLQQNDWDLLLLD
VDMPAPNGFDILRSLSGREHNRMVVMVSALSDRESRCSSLKLGANDFISKPLDLPELLLR
VRNQLQLSWASKQLKIERETLERKVCERTEQLNASYQSVICSLSRAAQYKDDETGQHIIR
IGESAALIAAALGQPAEWVERIRLAAPMHDVGKIGIPDHILLKPGTLTDLERKIMQRHTQ
IGHAILRDGEESPLLEMAAEIALYHHERWDGTGYPHGLKGEEIPLAARVVALCDVYDALR
SPRPYKESWSKERAQAYICEQAGLYFDPALVDVLNGMFQQIEDMQDSLADPLAQTASVGA
EQEYSESVVDALSPRRRARS