Protein Info for HP15_2593 in Marinobacter adhaerens HP15

Annotation: monovalent cation/proton antiporter, MnhG/PhaG subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details TIGR01300: monovalent cation/proton antiporter, MnhG/PhaG subunit" amino acids 8 to 102 (95 residues), 86 bits, see alignment E=8.8e-29 PF03334: PhaG_MnhG_YufB" amino acids 9 to 88 (80 residues), 89 bits, see alignment E=9.6e-30

Best Hits

KEGG orthology group: K05571, multicomponent Na+:H+ antiporter subunit G (inferred from 70% identity to maq:Maqu_2861)

Predicted SEED Role

"Na(+) H(+) antiporter subunit G" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIV6 at UniProt or InterPro

Protein Sequence (135 amino acids)

>HP15_2593 monovalent cation/proton antiporter, MnhG/PhaG subunit (Marinobacter adhaerens HP15)
MSEIFVSILLLAGASFMVLAAIGIVRLPDLPTRMHASTKAGAMGAILTMAGVALHFSDSA
VAARAIAFIVFILLTAPIAAHVIGRAGYFTGISLWSGTTKDELRERYDPDTHKLYSGLET
KTDRAVPDNNKDGSG