Protein Info for Psest_2699 in Pseudomonas stutzeri RCH2

Annotation: benzoate 1,2-dioxygenase, large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 TIGR03229: benzoate 1,2-dioxygenase, large subunit" amino acids 8 to 440 (433 residues), 898.5 bits, see alignment E=3.5e-275 PF00355: Rieske" amino acids 45 to 128 (84 residues), 58.4 bits, see alignment E=5.3e-20 PF00848: Ring_hydroxyl_A" amino acids 195 to 385 (191 residues), 58.7 bits, see alignment E=7.8e-20

Best Hits

Swiss-Prot: 80% identical to XYLX_PSEPU: Toluate 1,2-dioxygenase subunit alpha (xylX) from Pseudomonas putida

KEGG orthology group: K05549, benzoate 1,2-dioxygenase alpha subunit [EC: 1.14.12.10] (inferred from 86% identity to pmk:MDS_4170)

MetaCyc: 80% identical to XylX (Pseudomonas putida mt-2)

Predicted SEED Role

"Benzoate 1,2-dioxygenase alpha subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKD6 at UniProt or InterPro

Protein Sequence (453 amino acids)

>Psest_2699 benzoate 1,2-dioxygenase, large subunit (Pseudomonas stutzeri RCH2)
MSLGIDYLDSLLEEDKEKGIFRCKREIFTAPELFELEMKHIFEGNWIYLAHESQIPEKND
YYTTTMGRQPIFIARNKDGVLNAFINACSHRGATLCRYKRGNKATYTCPFHGWTFNNSGK
LLKVKDPKEAGYPESFDCDGSHDLKKVARFESYRGFLFGSLNPDVSSLEDFLGESRKIID
MIVDQSPEGLEVLRGSSTYVFDGNWKLQAENGADGYHVTAVHWNYAATQQQRKLKDAGDD
IRAMSAGGWGKKGGGFYSFENGHMLLWTRWDNPEDRPLFSQRDRLVEEFGEARADWMIGH
SRNLCLYPNLYLMDQFGSQLRIARPISVDKTEVTIYCIAPKGESAEARARRIRQYEDFFN
VSGMATPDDLEEFRACQEGFQGRSLQWNDMSRGAAHWIEGADESAQQIDLHPLLSGVRTE
DEGLYVVQHGYWRDQMVKAVKKEQDQLIHVEGA