Protein Info for HP15_2584 in Marinobacter adhaerens HP15

Annotation: pH adaption potassium efflux system protein PhaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 signal peptide" amino acids 12 to 19 (8 residues), see Phobius details transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details PF01899: MNHE" amino acids 14 to 159 (146 residues), 148.1 bits, see alignment E=8.1e-48

Best Hits

KEGG orthology group: K05562, multicomponent K+:H+ antiporter subunit E (inferred from 82% identity to maq:Maqu_2852)

Predicted SEED Role

"Na(+) H(+) antiporter subunit E" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIU7 at UniProt or InterPro

Protein Sequence (162 amino acids)

>HP15_2584 pH adaption potassium efflux system protein PhaE (Marinobacter adhaerens HP15)
MLDRLSFPQPWLSLTLFITWQFLSDGISGGSAVLGLILAWAIPQITQGFWPDPPAFIKAW
RVPAYLLRVVWDIVIASVEVARLILSPRPARPAFVCYPLELEHPLAITILASTISLTPGT
VSADVSDDNKLLLIHALDAEDDQTVIDTIKTRYEKPLLEMFQ