Protein Info for PGA1_c02760 in Phaeobacter inhibens DSM 17395

Annotation: putative methylated-DNA--protein-cysteine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF02805: Ada_Zn_binding" amino acids 11 to 73 (63 residues), 96.3 bits, see alignment E=1.3e-31 PF12833: HTH_18" amino acids 106 to 179 (74 residues), 49.4 bits, see alignment E=7e-17 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 266 to 345 (80 residues), 109.1 bits, see alignment E=4.4e-36 PF01035: DNA_binding_1" amino acids 268 to 346 (79 residues), 112.6 bits, see alignment E=9.8e-37

Best Hits

KEGG orthology group: K10778, AraC family transcriptional regulator, regulatory protein of adaptative response / methylated-DNA-[protein]-cysteine methyltransferase [EC: 2.1.1.63] (inferred from 72% identity to sno:Snov_4045)

Predicted SEED Role

"ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.63

Use Curated BLAST to search for 2.1.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DX39 at UniProt or InterPro

Protein Sequence (356 amino acids)

>PGA1_c02760 putative methylated-DNA--protein-cysteine methyltransferase (Phaeobacter inhibens DSM 17395)
MLFDLPDHEALYQALLTRDDRYDGQAYVCVATTGIFCRLTCPARKPKRENCQFFGSVGEC
IEAGFRACKRCHPLRPMAEADPAVATLLAALDERPDYRWGEGDITRMGLDLSTVRRSFKR
QFGMTFLEMARQRRLREGFTVLSDGGKVIEAQLDAQFDSPSAFRAAFARLLGRAPGSLTR
EGLLLADWIPTPLGDMIAVSSRTELHLLEFVERRALKGELDKLQRAVKGDLGIGPTPPSE
QIRAELDAFFAGRSARFETPLAYHGTAFMQQVWDALRQIPPGITRSYSEIARTIGRPDAT
RAVARANGANQIALVVPCHRVIGADGSLTGYGGGLWRKQRLLDIERQYRTSAAQPV