Protein Info for HP15_2582 in Marinobacter adhaerens HP15

Annotation: NADH-ubiquinone oxidoreductase, chain 4L

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details PF00420: Oxidored_q2" amino acids 5 to 103 (99 residues), 68.5 bits, see alignment E=1.7e-23

Best Hits

Swiss-Prot: 55% identical to PHAC1_RHIME: Probable K(+)/H(+) antiporter subunit C (phaC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05560, multicomponent K+:H+ antiporter subunit C (inferred from 89% identity to maq:Maqu_2850)

Predicted SEED Role

"Na(+) H(+) antiporter subunit C" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIU5 at UniProt or InterPro

Protein Sequence (122 amino acids)

>HP15_2582 NADH-ubiquinone oxidoreductase, chain 4L (Marinobacter adhaerens HP15)
MELVFALVIGALTASGVYLILRARTFPVVVGLTMLSYGVNLFLFSSGRLATGQQPVLGTA
ASYSDPLPQALVLTAIVIGFAMTAFVVVLSLRNLADNEDDHVDGKQPYKSPAPEQEEEVN
GK