Protein Info for HP15_2580 in Marinobacter adhaerens HP15

Annotation: 2,4-dienoyl-CoA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 684 PF00724: Oxidored_FMN" amino acids 8 to 333 (326 residues), 260.6 bits, see alignment E=1.3e-80 PF01266: DAO" amino acids 378 to 414 (37 residues), 30.7 bits, see alignment 1.4e-10 PF07992: Pyr_redox_2" amino acids 378 to 664 (287 residues), 91.1 bits, see alignment E=4.9e-29 PF00070: Pyr_redox" amino acids 378 to 415 (38 residues), 23.6 bits, see alignment 3.3e-08 PF03486: HI0933_like" amino acids 378 to 415 (38 residues), 31.3 bits, see alignment 5.4e-11 PF00890: FAD_binding_2" amino acids 379 to 418 (40 residues), 29.6 bits, see alignment 2.3e-10 PF01134: GIDA" amino acids 379 to 407 (29 residues), 24 bits, see alignment (E = 1.1e-08) PF12831: FAD_oxidored" amino acids 379 to 415 (37 residues), 35.8 bits, see alignment 3.4e-12 PF13450: NAD_binding_8" amino acids 381 to 422 (42 residues), 42.4 bits, see alignment 3.9e-14 PF01593: Amino_oxidase" amino acids 387 to 413 (27 residues), 21 bits, see alignment (E = 1e-07)

Best Hits

KEGG orthology group: None (inferred from 93% identity to maq:Maqu_2848)

Predicted SEED Role

"2,4-dienoyl-CoA reductase [NADPH] (EC 1.3.1.34)" (EC 1.3.1.34)

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.34

Use Curated BLAST to search for 1.3.1.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIU3 at UniProt or InterPro

Protein Sequence (684 amino acids)

>HP15_2580 2,4-dienoyl-CoA reductase (Marinobacter adhaerens HP15)
MSDTYPNLLKPLDLGFTELKNRVLMGSMHTGLEDRFWNIHKFARYFAERAEGGVGLMVTG
GFSPNLVGQLAPLASTMNNRATALLHRHVTGAVHEAGGKICMQILHAGRYGYQPLIVSAS
ATKAPISPFKARALSSKGVERQINDFVSAAKLAKFAGYDGVEVMGSEGYFINQFLCERTN
KRTDKWGGPYENRMRLPVEIVRRMREAVGPEFIIIYRLSMLDLVEGGQTWDQIVTLGKAI
EQAGATIINTGIGWHEARVPTIVTSVPRGGFADVTAKFYGEVDIPVCTTNRINTPEKGEE
ILAAGKADMVSMARPLLADSEFVRKAEQGRSDEINTCIACNQACLDHAFQAKRASCLVNP
RACHETELVLTVAPVVRRVAVVGAGPAGLAAATTAAKRGHKVTLFDADDRIGGQFNYAKR
IPGKEEFYETLRYYQRQIELLEIDLKLGTRVDADSLKAQGFDDVVIATGVKPRTPAIEGI
DHPKVLGYLDVLRHNKPVGETVAVIGAGGIGFDVSEFLTHDFSHHPEGEQVSVADWQAEW
GVNPDFDGPGGLAERQPTPSPRKIYLMQRKTGKVGGGLGKTSGWVHRNSLKHREVEMLRG
CRYERIDDQGLHISLTDKDGKVTESRVLAVDNVIICAGQEPYRELFDELSDSGVTAHLIG
GADVAEELDAKRAIRQGTEVAAKL