Protein Info for Psest_2677 in Pseudomonas stutzeri RCH2

Annotation: ABC-type multidrug transport system, ATPase and permease components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 280 to 307 (28 residues), see Phobius details PF00664: ABC_membrane" amino acids 22 to 310 (289 residues), 96.9 bits, see alignment E=1.8e-31 PF00005: ABC_tran" amino acids 372 to 520 (149 residues), 109.8 bits, see alignment E=1.7e-35

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 96% identity to psa:PST_1687)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GN21 at UniProt or InterPro

Protein Sequence (592 amino acids)

>Psest_2677 ABC-type multidrug transport system, ATPase and permease components (Pseudomonas stutzeri RCH2)
MADQLSWAEIRRLALHHRKALILANLVAVLATLCSVPIPLLLPLLVDEVLLGAGDTALQV
MDRFLPASWESAAGYIGLMLGITLVLRASALVFNVLQARLFARLSKDIVYRIRVRLIERL
KRIALAEYESLGGGTVAAHLVTDLETIDKFIGDTLSRLLVAVLSIIGTAAILVWMHWQLA
LLILLFNPLVIFATVQLGKRVKHLKKLENDSTSRFTQALTETLDAIQEVRAGNRQGFFLG
RLGLRAREVRDYAVASQWKTDASNRASGLLFQFGIDVFRAAAMLTVLFSDLSIGQMLAVF
SYLWFMIGPVEQLLSLQYAFYAAGGALGRINQLLARADEPQYPGGRDPFAGQTTVAIEVR
GLQFAYQDEPVLEGLDLSIAPGEKVAIVGASGGGKSTLVQLLLGLYQPQAGQIRFGGVPL
EEIGLSTVRDNVAVVLQHPALFNDSVRANLMMGREREDDACWRALEIAQLADTIRQLPNG
LDSIVGRSGVRLSGGQRQRLAVARMILAEPKVVILDEATSALDAATEYALHQGLNRFLQG
RTTLIIAHRLSAVKQADRVLVFDGGRIAEDGDHQQLIAEGGLYARLYGHLQH