Protein Info for Psest_2675 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane-bound metal-dependent hydrolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 58 to 76 (19 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 125 to 151 (27 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details PF04307: YdjM" amino acids 1 to 178 (178 residues), 118.7 bits, see alignment E=1e-38

Best Hits

KEGG orthology group: K09151, hypothetical protein (inferred from 87% identity to psa:PST_1689)

Predicted SEED Role

"Membrane-bound metal-dependent hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GP82 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Psest_2675 Predicted membrane-bound metal-dependent hydrolases (Pseudomonas stutzeri RCH2)
MDSITQALLGASVQGAMLGRWQGRKALAYGAVLGTLPDLDVVIDYGDAVANMTYHRGFSH
SLFVLSVVAVLLTWLVRRFRPDPRYSGTRLFVTVWLVLVTHVLLDAFTSYGTQLLWPLAT
PPVAWSSVFIIDPLYSVPLLLAVLAAGLFGLSGRIARWPTYALIISTGYLGFTLAGKQMA
EHRVQATVASQGIQAERMFSTPTPFNSLLWRVILVDGEHYYETLVSWWDDAPPSLVRLPR
NVHLAKVLSDSPQHERLQWFTGNVLRYDEDGSQLLVTDLRLGMTGFHPFRFPLAERTAKG
WQLVPLPERLPANRGDMSRLASLWQRIWQQEPALPLAAWAAELNGSR