Protein Info for PGA1_c02740 in Phaeobacter inhibens DSM 17395

Annotation: sn-glycerol-3-phosphate import ATP-binding protein UgbC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF00005: ABC_tran" amino acids 23 to 162 (140 residues), 119.6 bits, see alignment E=3.4e-38 PF17912: OB_MalK" amino acids 236 to 280 (45 residues), 33.2 bits, see alignment 1.6e-11 PF08402: TOBE_2" amino acids 273 to 338 (66 residues), 25.2 bits, see alignment E=2.9e-09

Best Hits

Swiss-Prot: 64% identical to UGPC_PSYIN: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Psychromonas ingrahamii (strain 37)

KEGG orthology group: K05816, sn-glycerol 3-phosphate transport system ATP-binding protein [EC: 3.6.3.20] (inferred from 65% identity to rcp:RCAP_rcc01021)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETK1 at UniProt or InterPro

Protein Sequence (348 amino acids)

>PGA1_c02740 sn-glycerol-3-phosphate import ATP-binding protein UgbC (Phaeobacter inhibens DSM 17395)
MAQVTLNSVRKVYPNGVEAVTSSSFKIEDGEFVVLVGPSGCGKSTLLRMIAGLEDITEGT
LEIGDRVVNNVDPADRDIAMVFQNYALYPHMTVRKNIAYGLKNRKTPEAEIKQKVAEAAK
MLNLEEYLDRKPSQLSGGQRQRVAMGRAIVRDPALFLFDEPLSNLDAKLRNQMRIEIKAL
QRRLGVTSIYVTHDQVEAMTMADRIIVLNGGRIEQIGTPSEIYHNPASVFVASFMGAPPM
NLLDATIANGQVTLPDGVSMGALDTSAQGAVKLGIRPEDVQLVAEGGLAIDVELIEELGA
HRLLHGKLGGQPFTIHVLKDIPVDPGTHQISVDPAAICLFDAESGQRR