Protein Info for Psest_2669 in Pseudomonas stutzeri RCH2

Annotation: Acyl-CoA dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF02771: Acyl-CoA_dh_N" amino acids 6 to 116 (111 residues), 93.7 bits, see alignment E=2e-30 PF02770: Acyl-CoA_dh_M" amino acids 121 to 219 (99 residues), 71.8 bits, see alignment E=9e-24 PF00441: Acyl-CoA_dh_1" amino acids 232 to 366 (135 residues), 126.9 bits, see alignment E=1.5e-40 PF08028: Acyl-CoA_dh_2" amino acids 249 to 360 (112 residues), 48.5 bits, see alignment E=2.3e-16

Best Hits

KEGG orthology group: None (inferred from 97% identity to pmk:MDS_3406)

Predicted SEED Role

"Probable acyl-CoA dehydrogenase (EC 1.3.99.3)" in subsystem Isoleucine degradation or Valine degradation (EC 1.3.99.3)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.3

Use Curated BLAST to search for 1.3.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPD9 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Psest_2669 Acyl-CoA dehydrogenases (Pseudomonas stutzeri RCH2)
MNPNKTEELNFIREGVRALCAEFPAEYWRRIDEEKGFPEAFVTAMTEAGWLSAMIPEEYG
GSGLGLAEASVILEEVNHCGGNSGTIHGQMYNMFTLLRNGSEEQKRYYLPKLASGELRLQ
SMGVTEPTTGTDTTKIKTTAVRQGDKYVINGQKVWISRIQHSDLMILLARTTPLGEVQRK
SEGMSIFLVDLREAIGNGLTVQPIANMVNHETNELFFDNLEIPASSLIGEEGKGFRYILD
GLNAERTLIAAECIGDGRWFVEKSAQYARDRVVFGRPIGQNQGVQFPIAEAHIEIEAADL
MRWRACEEYDSGRNAGAAANMAKYLAAKASWEAANACLQTHGGFGFANEYDVERKFRETR
LYQVAPISTNLILSYVAEHLLELPRSF