Protein Info for PGA1_c02730 in Phaeobacter inhibens DSM 17395

Annotation: sn-glycerol-3-phosphate transport system permease protein UgpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 197 to 222 (26 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 102 to 288 (187 residues), 66.6 bits, see alignment E=1.3e-22

Best Hits

KEGG orthology group: K05815, sn-glycerol 3-phosphate transport system permease protein (inferred from 67% identity to jan:Jann_2077)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DLI3 at UniProt or InterPro

Protein Sequence (293 amino acids)

>PGA1_c02730 sn-glycerol-3-phosphate transport system permease protein UgpE (Phaeobacter inhibens DSM 17395)
MADQTPVQTPRRSINWGAVGDHTVLILGSLFMLVPLIMVVMTTTVPDVEIIKYGPQLKIG
DQFDENFEKAMFEASGFSGANTGTRMLFNSFVLGIGFALGKIVIAMMAAYAIVYFRLRFA
SLAFWVIFTTLLLPLEVRILPSYEVVQQLGMLNTYQGLIIPLIASATATFFFRQYFRSIP
EELVEAARIDGAGPVKFFIDILVPLSKTMIAAMFIIMFVFGWNQYLWPTMITTEEDMYTL
VRGIKQITQTLEGTNVPEFGRANLLAVIAILPPVAVVIFFQSWFVKGLTESDK