Protein Info for PGA1_c02720 in Phaeobacter inhibens DSM 17395

Annotation: sn-glycerol-3-phosphate transport system permease protein UgpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 72 to 291 (220 residues), 29.6 bits, see alignment E=5.6e-11

Best Hits

Swiss-Prot: 48% identical to UGPA_RHIME: sn-glycerol-3-phosphate transport system permease protein UgpA (ugpA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05814, sn-glycerol 3-phosphate transport system permease protein (inferred from 77% identity to jan:Jann_2076)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EW21 at UniProt or InterPro

Protein Sequence (293 amino acids)

>PGA1_c02720 sn-glycerol-3-phosphate transport system permease protein UgpA (Phaeobacter inhibens DSM 17395)
MKRAGFSTKWMPILLLMPQLVIIAIFFYWPAWHAIQSSFYLQDPFGFGSTFVGLDNYTDL
LGNSEYRRVAIFTLVFTVLVTFFSLAIALLLAVKADNVLRGARTYRTLLMWVYAVAPPVA
GFIGLIMFDQSWGPLTRLAGFFGWDFVLGVNFNDTAAAMVLVSVWKQIPVNFIFFLSGLQ
SIPRSVREAALIDNRSATGRFWDVTFPLLAPTGFFLLIINITYALFDTFGIVDTLVKGEP
GNNPMTLVYKVYVDGFRGNDLGGSSAQSVILMVLVLALTIFQFRLIDRRIHYT