Protein Info for Psest_2642 in Pseudomonas stutzeri RCH2

Annotation: 5'-deoxy-5'-methylthioadenosine phosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 TIGR01694: methylthioadenosine phosphorylase" amino acids 4 to 244 (241 residues), 299.3 bits, see alignment E=9.1e-94 PF01048: PNP_UDP_1" amino acids 4 to 244 (241 residues), 156.2 bits, see alignment E=4.8e-50

Best Hits

Swiss-Prot: 78% identical to MTIP_PSEAE: S-methyl-5'-thioinosine phosphorylase (PA3004) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00772, 5'-methylthioadenosine phosphorylase [EC: 2.4.2.28] (inferred from 90% identity to psa:PST_1738)

MetaCyc: 78% identical to S-methyl-5'-thioinosine phosphorylase monomer (Pseudomonas aeruginosa PAO1)
RXN-12241 [EC: 2.4.2.44]

Predicted SEED Role

"5'-methylthioadenosine phosphorylase (EC 2.4.2.28)" in subsystem Methionine Salvage (EC 2.4.2.28)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.28 or 2.4.2.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK89 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Psest_2642 5'-deoxy-5'-methylthioadenosine phosphorylase (Pseudomonas stutzeri RCH2)
MTVYAIIGGTGLTQLTGFKLHRAQLIDTPYGRPSGEVLRGEYGDREVLFLARHGHPHRIP
PHQVNYRANLWALKQAGAEAILAVNAVGGIHSAMGSGHFCVPHQIIDYTYGREHTFFEGE
IDHVTHIDFSYPYDEALRALLIGALAAEGYAFSSHGVYGCTQGPRLETAAEIARMERDGC
DIVGMTGMPEAALARELDLAYACLSLVVNPAAGKASGVITMAEIETALSAGIGKARQVLA
RVLAE