Protein Info for Psest_0260 in Pseudomonas stutzeri RCH2

Annotation: Cell division protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 62 to 84 (23 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 260 to 283 (24 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details PF18075: FtsX_ECD" amino acids 98 to 205 (108 residues), 68.5 bits, see alignment E=5.8e-23 PF02687: FtsX" amino acids 216 to 331 (116 residues), 39.4 bits, see alignment E=5.7e-14

Best Hits

Swiss-Prot: 75% identical to FTSX_PSEPU: Cell division protein FtsX (ftsX) from Pseudomonas putida

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 95% identity to psa:PST_3990)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFT2 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Psest_0260 Cell division protein (Pseudomonas stutzeri RCH2)
MSSERNPKTTPSTAERVGGSVKKPEQPHSDEPDFKTLFHAWLESHRASLVDSLGRLLKQP
IGSFFTCLVMAVALSLPMGLALLLDNVERLGGSWQRAAQISLFMQLDVDAGAGERLRDEV
ADMPDVATADWVSREQALEEFQQLSGLGEALKELPENPLPGVIVVTPNEVDKDKLEALRL
QLAELPGVQQAQLDLLWVERLTAILKLGDRFVFGLTLLLIATLLLVIGNTIRLHIENRRT
EIEVVKLVGGTDGYVRRPFLYMGAIYGLGAGLIAWLLLAYGLGWLNEAVVSLAGLYGSDF
GLEGVPAGDALSLVIGAVLLGYIGAWLAVARHLSELAPR