Protein Info for Psest_2635 in Pseudomonas stutzeri RCH2

Annotation: choline/carnitine/betaine transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 270 to 294 (25 residues), see Phobius details amino acids 323 to 343 (21 residues), see Phobius details amino acids 355 to 374 (20 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details amino acids 456 to 476 (21 residues), see Phobius details amino acids 482 to 502 (21 residues), see Phobius details PF02028: BCCT" amino acids 22 to 508 (487 residues), 615.5 bits, see alignment E=2.9e-189 TIGR00842: transporter, betaine/carnitine/choline transporter (BCCT) family" amino acids 60 to 507 (448 residues), 528.2 bits, see alignment E=8.4e-163

Best Hits

KEGG orthology group: K02168, high-affinity choline transport protein (inferred from 98% identity to psa:PST_1744)

Predicted SEED Role

"High-affinity choline uptake protein BetT" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMC2 at UniProt or InterPro

Protein Sequence (688 amino acids)

>Psest_2635 choline/carnitine/betaine transport (Pseudomonas stutzeri RCH2)
MNEAELSPNDSEAPADRINPVVFYGSAIAIVLFAVWTMFFTDRSLAVINTVLGWISNTFG
WFYFLAVLLYLLFVVVVATSRYGKIRLGPDHSKPEFNVVTWAAMLFSAGIGIDLLFFCIA
EPITQFLEPPVGEGGSTQAARHAMELTFLHWGLSGWGVYTLVGMSLAYFSFRQGLPLSIR
SSLYPIFGKRIYGPIGHTVDTAAVLGTIFGIATSLGIGIIQLNFGLNYIFGIPEGTLTQA
VLVVLIVVFSAISAATGVERGIRRLSEFNMLLAVLLLLFVLVVGDTVFLLNALVMNVGDY
FSNFISLSLDTYAYRRPTDWLNAWTVFFWAWWIAWGPFVGLFLARISRGRTIREFVIGTL
LLPLAFMMAWMSIMGNSAIEMVMGGALEFGQQAVSNPGSSIYLFLQSLPWAGLTTIVVTI
LAIVFFVTSGDSGSLVLSNFTSILKDVNSDAPVWMRILWAAIIGVLTLALLIAGGLTALQ
GTVVIMGLPFSIVLLFMMYGLFKALHVEGVMADSYQKSLSGYLSGRATLEHTQMNWSQRL
SRAMSFPSRSQIRRYLKDVCKPAMEEIQKALGEKGVPVDIVEGEPGNEHLALHVNLGSEQ
DFTYQIWPVRGTMPSFALRTQSGNADYYRLEVHLRQGSLGYDLMGYSRRQLIEDILDHYE
HHMHFLHLQRENGGGESGMPNPGAAPTP