Protein Info for Psest_0259 in Pseudomonas stutzeri RCH2
Annotation: cell division ATP-binding protein FtsE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 56% identical to FTSE_ECOLI: Cell division ATP-binding protein FtsE (ftsE) from Escherichia coli (strain K12)
KEGG orthology group: K09812, cell division transport system ATP-binding protein (inferred from 99% identity to psa:PST_3991)MetaCyc: 44% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427
Predicted SEED Role
"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)
MetaCyc Pathways
- lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GHH8 at UniProt or InterPro
Protein Sequence (223 amino acids)
>Psest_0259 cell division ATP-binding protein FtsE (Pseudomonas stutzeri RCH2) MIRFEQVGKRYPNGHVGLHELSFQVRRGEFLFVTGHSGAGKSTLLRLLLAMERPTSGKLL LAGQDLSRITNSQIPFLRRQIGVVFQNHQLLFDRTVFDNVGLPLQILGLNKREIGQRVMT ALERVSLKDKALQYPADLSTGQQQRVGIARAVVHRPALLLADEPTGNLDPRLAAEIMGVF EDINRLGTTVLIASHDLALIARMRHRMLTLQRGRLIGDGEASR