Protein Info for PGA1_c26160 in Phaeobacter inhibens DSM 17395

Annotation: uvrABC system protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 732 TIGR00631: excinuclease ABC subunit B" amino acids 29 to 681 (653 residues), 1006.1 bits, see alignment E=3.2e-307 PF04851: ResIII" amino acids 40 to 164 (125 residues), 47.2 bits, see alignment E=7.3e-16 PF00270: DEAD" amino acids 42 to 112 (71 residues), 26.5 bits, see alignment E=1.5e-09 PF17757: UvrB_inter" amino acids 186 to 274 (89 residues), 104.7 bits, see alignment E=6.5e-34 PF00271: Helicase_C" amino acids 460 to 570 (111 residues), 68.6 bits, see alignment E=1.7e-22 PF12344: UvrB" amino acids 577 to 618 (42 residues), 79.1 bits, see alignment 5.2e-26 PF02151: UVR" amino acids 653 to 683 (31 residues), 36.8 bits, see alignment (E = 6.9e-13)

Best Hits

Swiss-Prot: 71% identical to UVRB_ZYMMO: UvrABC system protein B (uvrB) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 90% identity to sit:TM1040_0144)

MetaCyc: 62% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E3H6 at UniProt or InterPro

Protein Sequence (732 amino acids)

>PGA1_c26160 uvrABC system protein B (Phaeobacter inhibens DSM 17395)
MPYAHSDKSMPMMADRAPQHRPKLEGGREFVMHTEFDPAGDQPTAIKELSEGVLEGERNQ
VLLGATGTGKTFTMAKVIEETQRPAIILAPNKTLAAQLYGEFKGFFPENSVEYFVSFYDY
YQPEAYVARSDTYIEKESQINEQIDRMRHSATRSLLERDDVIIIASVSCIYGIGSVETYS
AMTQDLKVGDEYDQRQVMADLVAQQYKRNDQAFQRGSFRVRGDSLEIFPAHLEDRAWRLS
FFGEELEGITEFDPLTGEKTGTFDQIRVYANSHYVTPKPTLKQAVISIKEELKMRLDQLV
GEGKLLEAQRLEQRTNFDIEMLEATGHCNGIENYSRYLTGRAPGEPPPTLFEFIPDNAIV
FADESHVSVPQIGGMYKGDHRRKFTLAEHGFRLPSCMDNRPLKFEEWDAMRPQSVFVSAT
PSKWELEQSSGVFAEQVIRPTGLLDPQVEIRPVDMQVDDLLDEVRRVTADGFRTLVTTLT
KRMAEDLTEYMHEQGIKVRYMHSDIDTLERIEILRDLRLGAFDVLIGINLLREGLDIPEC
GLVAILDADKEGFLRSETSLIQTIGRAARNAEGRVIMYADRITGSMERALGETNRRRDKQ
IAYNEEHGITPATVKKNVEDVLAGLYAGDVDMNRVTATIDKPMHGANLEAHLAGLREQMR
KAAENLEFEEAARLRDEVKRLEAVDLAVSDDPLARQSAIEAASDAAVKSRGRSTAGKAGT
RAYRGKSQKKFS