Protein Info for Psest_2620 in Pseudomonas stutzeri RCH2

Annotation: Flp pilus assembly protein, ATPase CpaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF13614: AAA_31" amino acids 147 to 306 (160 residues), 55.4 bits, see alignment E=1.5e-18 PF09140: MipZ" amino acids 148 to 292 (145 residues), 28.6 bits, see alignment E=1.8e-10 PF01656: CbiA" amino acids 149 to 340 (192 residues), 41.6 bits, see alignment E=2.4e-14

Best Hits

KEGG orthology group: K02282, pilus assembly protein CpaE (inferred from 63% identity to pba:PSEBR_a4088)

Predicted SEED Role

"Type II/IV secretion system ATPase TadZ/CpaE, associated with Flp pilus assembly" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMB0 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Psest_2620 Flp pilus assembly protein, ATPase CpaE (Pseudomonas stutzeri RCH2)
MLKPTPPSAPAVSSARPLQLLISSRDAAALERLSTAIGSHPAWQVTTRLVNNGHTDPLFG
LDHLPDLLLLHVSNLWRDELAALLLRPASQRPPLLVCGPLDEREGLRLAMQAGARDFLAE
PVVAAELLAAIQRVAFESQAGVDAGGRLVAVMNAKGGSGATMLACNLAHQLSGHGARTLL
LDLDLQFGCVAHCLDVRPAHSHLEVLQRIDEMDGIALNGFCSHFSPTLHVLGGRPGELCL
TQDVRLEQLESLLDLARRHYDWVVVDLPRQIDHLTGITLEQADRIYVVLQQSLSHLKDAS
RLLAIMREDMGIQAQRIQVVVNRYDKAAAVSLQDITEALHCGEPIRLANDYAVVNESQNA
GVPLGLHAPRAPITQGIRQLSQALIGAQVEAPSLLKRTFGRLFGGSHAQ