Protein Info for Psest_2619 in Pseudomonas stutzeri RCH2

Annotation: Flp pilus assembly protein, ATPase CpaF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 PF00437: T2SSE" amino acids 116 to 394 (279 residues), 215.5 bits, see alignment E=4.5e-68

Best Hits

KEGG orthology group: K02283, pilus assembly protein CpaF (inferred from 86% identity to pba:PSEBR_a4087)

Predicted SEED Role

"Type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA subfamily" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GP24 at UniProt or InterPro

Protein Sequence (474 amino acids)

>Psest_2619 Flp pilus assembly protein, ATPase CpaF (Pseudomonas stutzeri RCH2)
MLSEFRNRLHRQTGKDSVPANPAATAEQPASWEADAPENLYETRTQLNSIEAEWRERIYQ
QLLKVMDLSLLDSMENAEATRQIRDICQRLLDDHAAPVSSSSRQLIIKQISDEVLGLGPL
EPLLADGTVSDILVNGHASVYVERHGKLQRTDVRFRDDQHLLNIIDRIVSSLGRRIDESS
PLVDARLKDGSRVNAIIPPLAIDGPSLSIRRFAVDLLSAESLVEMGTLTPAIALVLKAIV
RGRLNVLVSGGTGTGKTTMLNVLSSFIPHNERIVTIEDSAELQLQQPHVVRLETRPANIE
GRGEINQRELVRNSLRMRPDRIVIGEVRGPEALDMLAAMNTGHDGSITTIHANSPRDALG
RIENMVSMSGATFPIKALRQQIASAIDVVLQLERHEDGKRRLVSVQEINGMEGDIITMSE
IFTFERRGIGEKGEVLGEYRPSGMVPMFRDRLAKRGIELPLPLFRPDWMEVMQP