Protein Info for HP15_2511 in Marinobacter adhaerens HP15

Annotation: phosphatidylserine decarboxylase proenzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR00163: phosphatidylserine decarboxylase" amino acids 50 to 281 (232 residues), 258.4 bits, see alignment E=2.4e-81 PF02666: PS_Dcarbxylase" amino acids 64 to 282 (219 residues), 222.2 bits, see alignment E=2.7e-70

Best Hits

Swiss-Prot: 74% identical to PSD_MARHV: Phosphatidylserine decarboxylase proenzyme (psd) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 74% identity to maq:Maqu_2780)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PHY7 at UniProt or InterPro

Protein Sequence (284 amino acids)

>HP15_2511 phosphatidylserine decarboxylase proenzyme (Marinobacter adhaerens HP15)
MFDKLFVLSQYITPQLGVSNLAGRLADNDRSPALKNRVIKWFIGRYGVDMSEAAEPNPEA
YATFNDFFTRELKPGIRPLADGEKTLVSPVDGAISQLGQVTGDRVFQAKGQSFSLSELLG
GEEATTAPFADGEFSTIYLSPKDYHRIHMPMAGTLRQMIHVPGKLFSVNPVTAENVPNLF
ARNERVVCIFDTASGPMALVLVGAMIVGSVETRWAGVVVPGSRQVTSTRYEGEQAISFDK
GEEMGRFRLGSTVIMVMPKGSVSWNSDQVAGKTVRMGEAFGALA