Protein Info for Psest_2616 in Pseudomonas stutzeri RCH2

Annotation: Tfp pilus assembly protein PilF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13432: TPR_16" amino acids 55 to 116 (62 residues), 24.1 bits, see alignment E=2.3e-08 amino acids 213 to 266 (54 residues), 26 bits, see alignment 5.5e-09 amino acids 270 to 303 (34 residues), 16.7 bits, see alignment 4.5e-06 PF13176: TPR_7" amino acids 212 to 235 (24 residues), 14.4 bits, see alignment (E = 1.8e-05) PF13174: TPR_6" amino acids 213 to 236 (24 residues), 12.3 bits, see alignment (E = 0.00013)

Best Hits

KEGG orthology group: None (inferred from 37% identity to fbl:Fbal_2340)

Predicted SEED Role

"Flp pilus assembly protein TadD, contains TPR repeat" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMW2 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Psest_2616 Tfp pilus assembly protein PilF (Pseudomonas stutzeri RCH2)
MKRFGLLLLVSAVLGGCQSMGPDTGNSGRSVYSGDNALLYQVRKQAGSADQAMQLAALAY
RAGDLDQSLFQYLRAMELEPKRQDALVWVGRIHRERGNDQLAELAFTEVLAKQPDNLDAL
TEMGMLSLSQRDQDRARGLLHKAVSLDQRRQGVAIGETLPEPQALNVDQQSPLRLYNALG
VLADLNNRFALSEGYYQLALKIEPRSLLAQNSLGYSYYLAGRWQDAERTFRRALDQNGSY
TPLWRNYGLLLARTARYEEALSAFEQIGSRAQASNDVGYVCLVEGKLDEAEQFFRSALEQ
SPSHYLTAWENLERVRQLRKIRQLGLERAQSDVVAVVDAEVKVFPVP