Protein Info for Psest_2615 in Pseudomonas stutzeri RCH2

Annotation: Predicted acyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 229 to 246 (18 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 11 to 324 (314 residues), 77.6 bits, see alignment E=4.8e-26

Best Hits

KEGG orthology group: None (inferred from 84% identity to psa:PST_1748)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMA6 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Psest_2615 Predicted acyltransferases (Pseudomonas stutzeri RCH2)
MHTPTLADRDNNFDFLRFFAAAMVVFGHAYGLSGQAHQEPLRLFSGSYDSADIAVHVFFV
MSGFLIAGSWLNSHSVLDFAAKRALRILPALIVSVLFVVLVVGPLATRLPLSEYFAAPET
FAYLGNAVFITEFRLPGVFASNPFPDTVNGSLWTLPYEVLMYATVLTLGLLKVFGRSMAL
IGLVLMVGVHFYLIPVYEVQSDLLRKATRLGMFFYAGVVLYLYRQKLIWNWKLAALMVTA
NLLSARSDYWELVHVLTLPYLTLYLAQLRIPLLAGFGKAGDFSYGLYIFAFPLQQLLMHW
SDGSLPLLPFMLLSFAASLAAAVFSWHLIESPALKLKRYLPRRQRTTAPAVAVGNR