Protein Info for Psest_2611 in Pseudomonas stutzeri RCH2

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF13439: Glyco_transf_4" amino acids 15 to 191 (177 residues), 35.5 bits, see alignment E=1.5e-12 PF00534: Glycos_transf_1" amino acids 191 to 350 (160 residues), 79.4 bits, see alignment E=3.6e-26 PF13692: Glyco_trans_1_4" amino acids 204 to 332 (129 residues), 67.7 bits, see alignment E=2.1e-22

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_1751)

MetaCyc: 62% identical to GDP-Man:alpha-D-Gal-diphosphoundecaprenol alpha-1,3-mannosyltransferase (Salmonella enterica enterica serovar Newport)
RXN-21846 [EC: 2.4.1.379]

Predicted SEED Role

"Glycosyltransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.379

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMV8 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Psest_2611 Glycosyltransferase (Pseudomonas stutzeri RCH2)
MKVAIVHDWLVTYAGAERVLASLCAVWPDADLFTVIDFLSDEDRVHLGGKRATTTFIQQL
PKARTHYQKYLPLMPLAIEQLDMSSYDLIISSSHAVAKGVLTGPNQLHISYVHSPIRYAW
DLQHQYLHEASLERGIKAKLARMLLHYMRMWDQRTASGVDEFIANSHFIGRRINKSYRRQ
STVIYPPVDTRQFTLHEAKEDFYLTASRMVPYKKIPLIIEAFAAMPDKRLIVIGTGPEMD
KAREVAGPNVTLLGYQSFEVLRQHMQRAKAFVFAAEEDFGIAPIEAQACGTPVIAFGRGG
VLETVRGLDHPEPTGVFYPEQNTASIIAAIATFEAQRSRISAANCRSNSERFSIERFQQE
IRAFVEARLREARAYDGQDFFPSPAPNTPLYPAAVAPIKHA