Protein Info for Psest_2610 in Pseudomonas stutzeri RCH2

Annotation: Predicted acyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 261 to 278 (18 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 67% identity to psa:PST_1752)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMA1 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Psest_2610 Predicted acyltransferases (Pseudomonas stutzeri RCH2)
MERLAHIDALRGSAAILLIFQILLVPLLDSSWLLEHALDPGILACLWLLLGCGFVVPVSL
HSGAPGARGFVIRRLLRLAPVYLLAALLTAILLPAAPAWLPGVPTPNSGVAFEVIGGYGA
LPPLLLFYALCLALQALGLLRSVGQRAGCSLLLLTVALALALTQQLVETALPVTLPLVLS
LMFFASIWYDALHESSSYARRRAREYARYILRVYLLVVPVVFVAGWSAAATAWPRDLLSY
ALAIATFVLLTSRLALRPPLLVWLGSLSYSLYLLLPAMQRLSQLLTQTLNPSGLNADLIA
AVLGLLLTLGSALLCRQLLDLPLSRAGKRLTGQHDLMPLVRLHSR