Protein Info for Psest_2609 in Pseudomonas stutzeri RCH2

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF13439: Glyco_transf_4" amino acids 14 to 162 (149 residues), 45.9 bits, see alignment E=2e-15 PF13579: Glyco_trans_4_4" amino acids 15 to 160 (146 residues), 30.7 bits, see alignment E=1.2e-10 PF00534: Glycos_transf_1" amino acids 177 to 324 (148 residues), 90.2 bits, see alignment E=3.6e-29 PF13692: Glyco_trans_1_4" amino acids 180 to 316 (137 residues), 78.2 bits, see alignment E=2.4e-25 PF13524: Glyco_trans_1_2" amino acids 210 to 342 (133 residues), 34.7 bits, see alignment E=5.1e-12

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_1753)

Predicted SEED Role

"Glycosyl transferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GP18 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Psest_2609 Glycosyltransferase (Pseudomonas stutzeri RCH2)
MIAINARFLTQETRGVQRFAEQVCLELGAMRKDLTFLAPQDIRMHTSAERLQVRRVGRNR
GHLWEQIDLPLWLAKHGHPPLVSLCNTAPLIYRNQIATHHDITYVRHPESYSRAFRSLYK
GLTPLLLKRIKALITVSDFSRKEIARYYGYPSEKICVVPNAVAAKFRPPADGQSRDASRP
YLLAVSSPNAHKNFARMVAAFLSLEGFDDVELHIVGDSHSVFSGTDYSVAGNTRVRMLGR
LDDEQLVRQYQGATAFVFPSLYEGFGIPPLEAQACGCPVIAARAASIPEVLGESVLYFEP
MNIEDIARCMRHVLQDAGLRDDLRTLGLANVERYSWKRSAQTVSQLIDQALMGKPSPPNF
AWSSGRH