Protein Info for Psest_2602 in Pseudomonas stutzeri RCH2

Annotation: Glycosyltransferases involved in cell wall biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 263 to 282 (20 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 21 to 135 (115 residues), 28.2 bits, see alignment E=1.5e-10 PF00535: Glycos_transf_2" amino acids 22 to 138 (117 residues), 73.6 bits, see alignment E=1.9e-24

Best Hits

KEGG orthology group: None (inferred from 94% identity to psa:PST_1760)

Predicted SEED Role

"putative glycosyltransferase - possibly involved in cell wall localization and side chain formation of rhamnose-glucose polysaccharide" in subsystem Rhamnose containing glycans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK53 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Psest_2602 Glycosyltransferases involved in cell wall biogenesis (Pseudomonas stutzeri RCH2)
MELKSEQALIERWGGKTEPLLSVVCLAYNHASFIRKTLESFLQQETDFPFEVIVHDDAST
DTTAAIIADYAARYPSIIKPIYQTQNQFSLGVPFSTRLFARAAGKYIAYCEGDDYWTDPS
KLQQQVDFLEQHRDYVITYHDAFMFNSQGIIQSPQLTGKLRKDATAQELMQGRPLSTLTV
CFRNLIQELPPELLGVEVLDICWWSLLGAYGKGKFMEGISPAAYRVHEGGIFSMRPSRQR
IQMAMHAHYSLARYYNRIGNNALYEYFLIQVFGACLALISPFSKLQALSTIAQNISLNLL
RRLSPRLARS