Protein Info for PGA1_c02670 in Phaeobacter inhibens DSM 17395

Annotation: quinone oxidoreductase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 256 to 275 (20 residues), see Phobius details PF08240: ADH_N" amino acids 28 to 116 (89 residues), 40.4 bits, see alignment E=4.6e-14 PF00107: ADH_zinc_N" amino acids 160 to 285 (126 residues), 64.4 bits, see alignment E=1.6e-21 PF13602: ADH_zinc_N_2" amino acids 191 to 325 (135 residues), 47.5 bits, see alignment E=5.3e-16

Best Hits

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 69% identity to sil:SPO0616)

Predicted SEED Role

"Oxidoreductase, zinc-binding dehydrogenase family"

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DLH9 at UniProt or InterPro

Protein Sequence (329 amino acids)

>PGA1_c02670 quinone oxidoreductase-like protein (Phaeobacter inhibens DSM 17395)
MKAITYRAFGSAETVLQLEDLPDIAPARGELRVELAYSGVNPSDVKARAGARAGVSELPY
PVIVPHSDGSGVIVEVGEGVDPARIGEEVWIWNGQWQRPNGTAACSITLPADQAVALPAG
LTLQQGAVLGIPGLTAAHTVFSGGDVGGKTVLVQGGAGTVGLLAVQLAKWGGARVVATCS
PEDFDRVRRVGADAVLSYAEDDLAEQILAANGGRPVDHIVEVEFGANCTVDTAVIAPNGR
IAAYGSARNMTPNLPFYPLMFKAVTLEMALVYLLPAEARHNAIERINAAAAQGALQPPIA
AVFDLVDTAKAHHAVEAGKRAGAILVKTG