Protein Info for PGA1_c25780 in Phaeobacter inhibens DSM 17395

Annotation: putative methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details PF00672: HAMP" amino acids 199 to 249 (51 residues), 36.9 bits, see alignment 5.5e-13 PF00015: MCPsignal" amino acids 377 to 531 (155 residues), 171.6 bits, see alignment E=2.2e-54

Best Hits

KEGG orthology group: None (inferred from 61% identity to sit:TM1040_3194)

Predicted SEED Role

"methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EPP3 at UniProt or InterPro

Protein Sequence (621 amino acids)

>PGA1_c25780 putative methyl-accepting chemotaxis protein (Phaeobacter inhibens DSM 17395)
MKFRNPARAALNRLSVFAKCSLLIAVSTLVVTLFLTWENQKILGEAVDSGVRTLAEGVTV
TVAARSGGAIRFGDTDRLESDLESLIELSNGRANHGIAINGKGKTVASTGVATEAEIAEL
TLVAQKAMETNQMEYSENGYLVAAPATAGAEGTVVVGAVGMVWSPDVAFAEVAPNQLLSF
LAAGGAFVVMLGLSVVALRSMMSRPLGDVATAINRLADGDYDHDTEHQTRGDEIGLIARH
IEALKAQLSAARTVEKQRHADQAAQKLVVERLNVGLQTLSEGDLSQTIDEEFSADYESLR
QNFNKTVDKMVGIIDAVIENSSRIRASAEEISQSSGDLSQRTESQAATLEETAAAMEQLT
VSVKSAADGAREVEGIVSEAKETAVNSGEVVTRAVDAMSKIEKSSEQISQIISVIDDISF
QTNLLALNAGVEAARAGEAGRGFAVVASEVRALAQRSSDAAQEIKALISESTSHVGEGVD
LVGRAGEELKQIIDRVATISGHVSGIATGAQEQSTTLGEINTGVTQLDQVTQHNAAMVEE
STAASQILRNDANELARQVSVFKTRKAAGNVVAMASNSPAPARPPAKAQPPAAPNPAPSA
HGDDDFFDASPTKAAAGWEDF