Protein Info for PGA1_c25750 in Phaeobacter inhibens DSM 17395

Annotation: NADH-quinone oxidoreductase subunits E/F (fused)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 PF01257: 2Fe-2S_thioredx" amino acids 53 to 187 (135 residues), 95.3 bits, see alignment E=6.2e-31 PF01512: Complex1_51K" amino acids 229 to 390 (162 residues), 152.9 bits, see alignment E=1.3e-48 PF10531: SLBB" amino acids 416 to 462 (47 residues), 37.7 bits, see alignment 3e-13 PF10589: NADH_4Fe-4S" amino acids 501 to 576 (76 residues), 75.9 bits, see alignment E=3.8e-25

Best Hits

KEGG orthology group: K00335, NADH dehydrogenase I subunit F [EC: 1.6.5.3] (inferred from 87% identity to sit:TM1040_3191)

Predicted SEED Role

"tungsten-containing formate dehydrogenase beta subunit" in subsystem Formate hydrogenase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F1P3 at UniProt or InterPro

Protein Sequence (576 amino acids)

>PGA1_c25750 NADH-quinone oxidoreductase subunits E/F (fused) (Phaeobacter inhibens DSM 17395)
MECRLNWRREVEVIVAPLDNSKGVWKSGKGKGRKTPKGRQLEDQAHSEVLDLIGDQPRNR
DLLIEFLHLIQDKYGCLSAAHIRALAEELRTGQAEIYEVASFYAHFDVVREGETPPPALT
IRVCDSLSCELAGAEALQKALEDGLDASQVRVLRAPCMGRCDTAPVLEIGHNHIDHATPE
KVQAAIAADDTHAHIPAYETFAAYEADGGYATLKDLRANGDWEAVQAKVKEAGLRGLGGA
GFPSGTKWGFVRANEGPRYLAVNGDEGEPGTFKDRYYLERTPHVFLEGMLIAAWAVEAEK
AFIYMRDEYPAVLEILRREITALEEAGIVEAGYIDLRRGAGAYICGEESAMIESIEGKRG
EPRHRPPFVAQVGIFGRPTLVHNVETLYWVCKVNREGPECLNSVEKNGRKGLRSYSVSGR
VKNPGVHLLPAGSTITDIIEACGGMLDGHAFKAYQPGGPSSGLLPASMHDIPLDFDTLQP
HGTFIGSAAVVVLSDKDSARDAALNMLRFFEDESCGQCTPCRVGCEKAVKLMGEKKWDQG
LLEELSAAMVDTSICGLGQAAPNPIRLTIKHFPEEV