Protein Info for Psest_2577 in Pseudomonas stutzeri RCH2

Annotation: general secretion pathway protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 644 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02517: type II secretion system protein D" amino acids 43 to 601 (559 residues), 531.5 bits, see alignment E=1.3e-163 PF21305: type_II_gspD_N0" amino acids 43 to 112 (70 residues), 85 bits, see alignment E=4e-28 PF03958: Secretin_N" amino acids 134 to 194 (61 residues), 49.7 bits, see alignment 5.3e-17 amino acids 199 to 263 (65 residues), 43 bits, see alignment E=6.6e-15 amino acids 269 to 345 (77 residues), 44.8 bits, see alignment E=1.7e-15 PF00263: Secretin" amino acids 425 to 593 (169 residues), 175.9 bits, see alignment E=8.6e-56

Best Hits

Swiss-Prot: 70% identical to GSPD_PSEAE: Secretin XcpQ (xcpQ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 96% identity to psa:PST_1786)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNZ0 at UniProt or InterPro

Protein Sequence (644 amino acids)

>Psest_2577 general secretion pathway protein D (Pseudomonas stutzeri RCH2)
MPTPFSRPLLALLATSLLAAPLPLLAAEQGIEPSTTRQDGWTINLKDADIRAFIDQISQL
SGQTFIVDPRVKGQVSVVSNATLSLSEVYQLFLSVMATHGFSVLTQGDVARVVPNAEAKA
EAGGGPSGGDQLETRVIQVQHTSAAELIPLIRPLVPQFGHLAAVSSANALIISDRSANIA
RIQNLVRQLDRAESNDYGVLNLQHGWAVDIAEVLRNSLMRGEAKTTAGVQIIADSRTNRL
IFIGPSEARGKLASLAQTLDTPTTRSANTRVIRLRHNDAKSLAETLGDISEGLKNPESGE
ATTTRPQNILIRADESLNALVLLADPELIGTMESIVRQLDVPRAQVMVEAAIVEVSGDIT
DALGVQWAVDARGSRGGAGGVNFGNTGISVGSVLNAINENEIPDNLPDGAIIGIGTRSFG
ALITALSSNSKSNLLSTPSLLTLDNQEAEILVGQNVPFQTGSYTTDAAGANNPFTTIERQ
DIGVTLKVTPHINEGATLRLQIEQEISSIAPSASLTAQAVDLVTNKRAIKSTILAEDGQV
IVLGGLIQDDVTRTNAKVPLLGDIPLLGALFRSTQETHIKRNLMVFLRPTVIRDRAGLAA
LSGKKYSDIRVIETDSASPTILPANPTQLFDGRGQPAPAIDLRQ