Protein Info for Psest_2563 in Pseudomonas stutzeri RCH2

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 50 to 74 (25 residues), see Phobius details amino acids 81 to 105 (25 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 210 to 234 (25 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 332 to 352 (21 residues), see Phobius details amino acids 362 to 388 (27 residues), see Phobius details signal peptide" amino acids 30 to 32 (3 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 327 (308 residues), 119 bits, see alignment E=1.1e-38

Best Hits

KEGG orthology group: None (inferred from 69% identity to psa:PST_1802)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNY3 at UniProt or InterPro

Protein Sequence (411 amino acids)

>Psest_2563 Arabinose efflux permease (Pseudomonas stutzeri RCH2)
MNAVLLAPPRRLVAWVILACGVVASLHLGKAAIAAPMLQTDLGVSLGQVGWLTGIFAVLG
LLGGAPAGAVAAALGGQRTLLMGLGITAFAGAAGGLAPSFALLLVSRLLEGLGFLLIIVG
GPAILERLLTGVARDKAFALWSCFMPCGMALVMVVGPLFPGWQWLWWASAALAVLAATMV
VYCIPRDASRGLSSRVIADVRQVLRSRATALLAIVFALYSLMFFALFSFLPVLLMERMDI
SYRSAGLLSALASVVNAGGNLAAGYLLGRGVGRSSLLIFASAVMGACGLGIFLGLFEAPT
TFLLCLLFSAVGGLIPATLLASAPLAVREATLVPIAVGLLMQGSNLGQLFGPVAVGSVTT
AFGWSAAGVVVLLAATAACASALLLRAALECDVPAAARRTTVAPAAKRGMH