Protein Info for Psest_2558 in Pseudomonas stutzeri RCH2

Annotation: cytochrome d oxidase, subunit II (cydB)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 7 to 37 (31 residues), see Phobius details amino acids 64 to 99 (36 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details TIGR00203: cytochrome d ubiquinol oxidase, subunit II" amino acids 5 to 212 (208 residues), 156.9 bits, see alignment E=4.5e-50 PF02322: Cyt_bd_oxida_II" amino acids 5 to 324 (320 residues), 348.1 bits, see alignment E=2.3e-108

Best Hits

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 96% identity to psa:PST_1808)

MetaCyc: 77% identical to cyanide insensitive ubiquinol oxidase subunit II (Pseudomonas putida KT2440)
RXN-6883 [EC: 1.10.3.11]

Predicted SEED Role

"putative Cytochrome bd2, subunit II" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 1.10.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNX9 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Psest_2558 cytochrome d oxidase, subunit II (cydB) (Pseudomonas stutzeri RCH2)
MGIDLSLIWAVIIIFGIMMYVVMDGFDLGVGILFPFVQDSSDRDVMMNTVAPVWDGNETW
LVLGGAGLFAAFPLAYSVVLSALYLPIIFMLMGLIFRGVAFEFRFKVVRERQHVWDKAFI
GGSLVATFFQGVVLGAFISGLPVEDRAYAGGALDWLTPFSLFCGLALIVAYALLGCTWLM
MRTAGDLQRRMHDIGIPLVWAVLVVTGIVSLWTPLTHPDIAERWFSMPNLLYFMPVPVLV
LLCAFGLLRSIQRYANYMPFLLTLALIFLGYSGLGISLWPNIIPPSVSIWEAAAPPQSQG
FTLVGALLILPLILMYTAWSYYVFRGKVSAEDGYH