Protein Info for Psest_2548 in Pseudomonas stutzeri RCH2

Annotation: Phosphoglycerate dehydrogenase and related dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF00389: 2-Hacid_dh" amino acids 28 to 256 (229 residues), 58.5 bits, see alignment E=9.2e-20 PF02826: 2-Hacid_dh_C" amino acids 109 to 255 (147 residues), 109.2 bits, see alignment E=2.4e-35 PF11890: DUF3410" amino acids 288 to 376 (89 residues), 70.2 bits, see alignment E=1.6e-23

Best Hits

Swiss-Prot: 87% identical to PDXB_PSEU5: Erythronate-4-phosphate dehydrogenase (pdxB) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K03473, erythronate-4-phosphate dehydrogenase [EC: 1.1.1.290] (inferred from 87% identity to psa:PST_1818)

Predicted SEED Role

"Erythronate-4-phosphate dehydrogenase (EC 1.1.1.290)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.290)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.290

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNX2 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Psest_2548 Phosphoglycerate dehydrogenase and related dehydrogenases (Pseudomonas stutzeri RCH2)
MHILADENIPLVDEFFAGLGEIRRMPGRSVNRAALENVDVLLVRSVTRVDRDLLEGTAVR
FVGTCTIGTDHLDLDYFERAGIDWASAPGCNARGVVDYVLGSLLTLAEVRGEALGQRRFG
VVGAGEVGGRLVEVLRGLGWDVRVCDPPREARETGGFVSLDEVLAECDVISLHTPLSMDG
AWPTFHLLDQQRLSRLRPGAWLINASRGAVMDNAALCDVLQQRPDIEAVLDVWEGEPQVD
VALAGLCRIATPHIAGYSLDGKLRGTAQIYTALCMARGLEPVVELAHLVPGAALTELTFA
SSAEPVDMLATLCRAVYDPRRDDADFRRSLMGDEAQRRATFDLLRKQYPSRREIDGLAVR
IVGRNPALEAVVAALGARLLD