Protein Info for Psest_2542 in Pseudomonas stutzeri RCH2

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 72 to 93 (22 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 80 to 241 (162 residues), 85.6 bits, see alignment E=1.9e-28

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 98% identity to psa:PST_1825)

Predicted SEED Role

"ABC transporter ATP-binding protein with unknown substrate"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GP14 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Psest_2542 ABC-type nitrate/sulfonate/bicarbonate transport system, permease component (Pseudomonas stutzeri RCH2)
MSQARRLTGPKKYLAVVLAILFILLIWQAAAWSLPAFLMPGIPTVFERLVTTVQQPEFRE
GLYGSMSRLGSGYSFALLFGIGFGLVGGVLFFFREILRSAIVILQSIPSIAWVPLFLIVM
GFGNLPIIVVVALAAFFPMALSVMNATESVQPVHVSAARVMGASRWQLLRRVYLPAVMPE
LITGAQLAFGNAWRALISAEMLIGFGQGLGRSLAYSGEIADMVGVMMNILVIAILATLID
QVVLEKFKQRMLRYQYV