Protein Info for PGA1_c02610 in Phaeobacter inhibens DSM 17395

Annotation: putative high-affinity branched-chain amino acid transport ATP-binding protein LivG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00005: ABC_tran" amino acids 19 to 179 (161 residues), 104.1 bits, see alignment E=1.5e-33 PF12399: BCA_ABC_TP_C" amino acids 230 to 254 (25 residues), 51.3 bits, see alignment (E = 9.7e-18)

Best Hits

Swiss-Prot: 42% identical to BRAF_PSEAE: High-affinity branched-chain amino acid transport ATP-binding protein BraF (braF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 78% identity to sil:SPO1849)

Predicted SEED Role

"Benzoate transport, ATPase component" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EW12 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PGA1_c02610 putative high-affinity branched-chain amino acid transport ATP-binding protein LivG (Phaeobacter inhibens DSM 17395)
MSLLEIEHATLKFGGVVAVNDLSFSVEEGEVYAIVGPNGAGKSTVFNLISRFYQPHSGRL
SFDGRDLLQSKADAVADLGIARTFQNIELFDHATVLQNLLVGRHRHRRSTLMEELFFTPR
VRREERRHRAAVEEVIDFLDLQAYRDKMIAGLPYGVRKVVELGRALASGPRLLLLDEPAS
GLSVEETRDMRWWIDDIRKQMGITVLMVEHDMGLVSSVSDRVLALADGAKLAEGTPAEVQ
ANPAVIEAYLGAGAV