Protein Info for Psest_2524 in Pseudomonas stutzeri RCH2

Annotation: cytochrome c oxidase, cbb3-type, subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 270 to 294 (25 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details amino acids 378 to 401 (24 residues), see Phobius details amino acids 434 to 453 (20 residues), see Phobius details TIGR00780: cytochrome c oxidase, cbb3-type, subunit I" amino acids 8 to 471 (464 residues), 763.4 bits, see alignment E=5e-234 PF00115: COX1" amino acids 12 to 443 (432 residues), 389 bits, see alignment E=1.4e-120

Best Hits

Swiss-Prot: 98% identical to CCON1_PSEST: Cbb3-type cytochrome c oxidase subunit CcoN1 (ccoN1) from Pseudomonas stutzeri

KEGG orthology group: K00404, cb-type cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 99% identity to psa:PST_1843)

MetaCyc: 89% identical to cbb3-1 cytochrome c oxidase subunit N (Pseudomonas putida KT2440)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase subunit CcoN (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM41 at UniProt or InterPro

Protein Sequence (474 amino acids)

>Psest_2524 cytochrome c oxidase, cbb3-type, subunit I (Pseudomonas stutzeri RCH2)
MNTATSTAYSYKVVRQFAIMTVVWGIVGMGLGVFIAAQLAWPFLNLDLPWTSFGRLRPLH
TNAVIFAFGGCALFATSYYSVQRTCQTTLFAPKLAAFTFWGWQLVILLAAISLPLGFTSS
KEYAELEWPIDILITIVWVAYAIVFFGTLATRKVKHIYVGNWFFGAFILTVAILHIVNNL
EIPVTAMKSYSVYAGATDAMVQWWYGHNAVGFFLTAGFLGIMYYFVPKQAERPVYSYRLS
IVHFWALITVYIWAGPHHLHYTALPDWAQSLGMVMSLILLAPSWGGMINGMMTLSGAWHK
LRSDPILRFLVVSLAFYGMSTFEGPMMAIKTVNALSHYTDWTIGHVHAGALGWVAMVSIG
ALYHLIPKVFGRAQMHSVALINTHFWLATIGTVLYIASMWVNGIAQGLMWRAINDDGTLT
YSFVEALEASHPGFVVRMIGGAIFFAGMLVMAYNTWRTVQAAKPAEYDAAAQIA