Protein Info for PGA1_c25080 in Phaeobacter inhibens DSM 17395

Annotation: ATP synthase epsilon chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01216: ATP synthase F1, epsilon subunit
  • amino acids 4 to 130 (127 residues), 75.3 bits, E=2.2e-25
• PF02823: ATP-synt_DE_N
  • amino acids 5 to 83 (79 residues), 79.6 bits, E=7.1e-27

Best Hits

Swiss-Prot: 79% identical to ATPE_RUEST: ATP synthase epsilon chain (atpC) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K02114, F-type H+-transporting ATPase subunit epsilon [EC: 3.6.3.14] (inferred from 79% identity to sit:TM1040_2085)

Predicted SEED Role

"ATP synthase epsilon chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

See I7EZ47 at UniProt or InterPro

Protein Sequence (137 amino acids)

>PGA1_c25080 ATP synthase epsilon chain (Phaeobacter inhibens DSM 17395)
MADTMQFDLVSPERRLASLPVTAVMIPGAEGDMTAMANHAPTITTLRPGVLRVESPQGTS
EYLVTGGFAEIGADGLSVLAEKAIPMDQLTRAQLDELIEEARTTYKTVQDTDQPHGLVED
AAKLLADMEALGTHMSL