Protein Info for Psest_2522 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 transmembrane" amino acids 149 to 168 (20 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 21 to 112 (92 residues), 36.3 bits, see alignment E=2.8e-13 PF00989: PAS" amino acids 21 to 112 (92 residues), 34.6 bits, see alignment E=3.3e-12 PF13426: PAS_9" amino acids 24 to 111 (88 residues), 36.9 bits, see alignment E=7.8e-13 PF08447: PAS_3" amino acids 31 to 115 (85 residues), 53.4 bits, see alignment E=5.1e-18 PF00015: MCPsignal" amino acids 322 to 488 (167 residues), 154.4 bits, see alignment E=5.4e-49

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 89% identity to psa:PST_1845)

Predicted SEED Role

"Aerotaxis receptor Aer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GP00 at UniProt or InterPro

Protein Sequence (522 amino acids)

>Psest_2522 PAS domain S-box (Pseudomonas stutzeri RCH2)
MRNNQPVTQREYAFPDQQRLVSTTDLKGQITYCNNIFVEVSGFDRDELIRAPHNLVRHPD
VPPAVFDHMWTTLKQGKPWMGIVKNRRKTGDHYWVNAYVTPILDQQRQVTGYESVRTKPT
REQVQRAEALYERINSGKSGVPQSDRWLPVLSKWLPFLIISQLGFLVGAGFDHALGFIAA
AALAVPLGLAGLQWQQRGLKRLLQLASQTTSDPLIARMYTDSRGVEAQLEMAMLSQQAHL
KTCLTRLQDTAVQLQGQAKQADSLAQSCANGLAQQNQETEQVATAINEMAATTQEVASNV
ALAAEATREASRLTIHGREVTAETRKAIQQLADSVASTGEAVNQLANDSDAIGGVVDVIK
SIADQTNLLALNAAIEAARAGDSGRGFAVVADEVRQLAQRTAEATGEIHQLIEKLQLQAR
HAVQTTEEGRVQATRGVDQVAQADQALTGINEAMGNIIDMTTQIASATEEQSAVADEISN
NVSTIARLADQTSGDARSSALLSEDLAATAEGQYALVERFNR