Protein Info for Psest_2516 in Pseudomonas stutzeri RCH2

Annotation: cytochrome c oxidase, subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 841 transmembrane" amino acids 41 to 63 (23 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 170 to 194 (25 residues), see Phobius details amino acids 208 to 233 (26 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 327 to 352 (26 residues), see Phobius details amino acids 362 to 385 (24 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details amino acids 433 to 457 (25 residues), see Phobius details amino acids 478 to 500 (23 residues), see Phobius details amino acids 589 to 608 (20 residues), see Phobius details amino acids 613 to 631 (19 residues), see Phobius details amino acids 662 to 687 (26 residues), see Phobius details amino acids 701 to 720 (20 residues), see Phobius details amino acids 736 to 758 (23 residues), see Phobius details amino acids 771 to 795 (25 residues), see Phobius details amino acids 816 to 838 (23 residues), see Phobius details TIGR02891: cytochrome c oxidase, subunit I" amino acids 33 to 536 (504 residues), 720.1 bits, see alignment E=6.9e-221 PF00115: COX1" amino acids 41 to 486 (446 residues), 499 bits, see alignment E=6.2e-154

Best Hits

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 96% identity to psa:PST_1850)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJY1 at UniProt or InterPro

Protein Sequence (841 amino acids)

>Psest_2516 cytochrome c oxidase, subunit I (Pseudomonas stutzeri RCH2)
MTPTRNNGAATDLDQLHDQFDEVWGNPRGWRALTIVNHTSIGLRFLVTGAFFFLVGGLLA
MLIRTQLALPGYELMEPDVYNQVFTMHGTVMMFLFAVPMMEGLAVYLIPKMIGARDLVFP
RLSALGYYCYLFGGLILLSSIFLDVAPKAGWFMYTPLSSSAHTPGVNSDFWLLGITFVEI
SAVSAGVELVVSILRTRTNGMALHKMPLYAWYILVMAMMIVVGFPPLILGSILLELERAA
GMPFFDVARGGDPVLWQHLFWLFGHPEVYIIFLPGAGIVSTLIPVFCQRPLVGYRWVVLG
VLTTGFISFGLWVHHMFTVGIPQLATAFFSAASMLVAIPTGVQIFAWLATLWLGKPVYRV
PMLWLVGFLIVFVAGGLTGVMLALVPFDWQVHDTHFVVAHMHYVLVGGMVFPLMAGLYYW
LPHFSGRMPSEKLGRWGFWLFFIGFNVTFLIMHWTGLIGMPRRVYTYDTGLGWDMPNLVS
SIGSFIMAAGVATILLDIILHFRFGIPAPKNPWKADTLEWATSLPPSAYNFVSLPDVTDR
HPLWKDPDLPDSIARGEHALTVIDHGRRETWGSDPLTGKVREIIHLPGNSWLPFIASVFL
AVLCLSLLNKAYILAIIATVATLIVLLRWSWENGAHPAAAPDAHTQPGEPPLHSRTFDGP
GLWGMGVTLLANGALYLSLLFGWFYLWTVSPQWQVPNSELNGWLMLASALLLSAGTLWLH
RLIKRLRAGIHHGLMGQLALIALVALLQSAMLLWLMLSAGLAPTETAHDAVIFVMLAYNL
IHCTLAAVLTALQAWRVAIGYVGDKAPYEPVVVEQLWYYNLGVLWVSYAAIVLFPATWGG
A