Protein Info for Psest_2515 in Pseudomonas stutzeri RCH2

Annotation: cytochrome c oxidase, subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details TIGR02866: cytochrome c oxidase, subunit II" amino acids 2 to 196 (195 residues), 181.4 bits, see alignment E=7.6e-58 PF00116: COX2" amino acids 110 to 185 (76 residues), 76.2 bits, see alignment E=1.1e-25

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 64% identity to pmy:Pmen_2266)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMM8 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Psest_2515 cytochrome c oxidase, subunit II (Pseudomonas stutzeri RCH2)
MARDVANVWWAMFGFSVLVLLVVSALWIYAMLRRPQTYTDEQALRINRRWIIGGGLILPT
VSIIALLAFGIPTGRGMLPLPVEGEQPLRIQVIGHQWWWEVRYPESGVVTANQFILPADR
PVDVEVTSADVIHSFWVPRLGGKLDMVPGRTNTLRLQASQAGVFRGQCSEFCGSQHAHMI
LHVEALEADAFASWIEARRELQHQPPSGDAGRVFAERCGQCHRVTGVSEGNRAPDLSDLA
TRPTLGAGVIANDADGLRRWLSDHQSLKHGIAMPRHDDIPEETLGQLADWLETLAP