Protein Info for HP15_2411 in Marinobacter adhaerens HP15

Annotation: type IV pilus prepilin peptidase PilD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 222 to 251 (30 residues), see Phobius details amino acids 264 to 288 (25 residues), see Phobius details PF06750: A24_N_bact" amino acids 21 to 125 (105 residues), 109.4 bits, see alignment E=7.5e-36 PF01478: Peptidase_A24" amino acids 138 to 247 (110 residues), 98.7 bits, see alignment E=2.5e-32

Best Hits

Swiss-Prot: 54% identical to LEP4_AERS4: Type 4 prepilin-like proteins leader peptide-processing enzyme (tapD) from Aeromonas salmonicida (strain A449)

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 84% identity to maq:Maqu_2683)

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PH72 at UniProt or InterPro

Protein Sequence (291 amino acids)

>HP15_2411 type IV pilus prepilin peptidase PilD (Marinobacter adhaerens HP15)
MLDLETLLGTPWLLYLSVILVSLCVGSFLNVVILRLPKMMHQDWRCQCEEFLELPEKQRK
EEERITLAKPASTCPSCGHGIRAWENIPVLSWLVLRGKCASCKAPISPRYPIIEAVTAIF
SVVTIAVIGPNESALWALLLVWALVALTVIDFDTQLLPDSITLPLMWLGLVLNYFGVLTD
FNSAFWGAVVGYLALWSVYWLFKLVTGKEGMGHGDFKLLAALGAWLGWQLLPAVILLSSV
VGAVVGIGLMVFKQHGREVPIPFGPYLATAGLLCLWFGTEIQAFWYGFLGV