Protein Info for Psest_2513 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 75 to 100 (26 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details PF03653: UPF0093" amino acids 3 to 137 (135 residues), 48.8 bits, see alignment E=4.9e-17

Best Hits

KEGG orthology group: None (inferred from 97% identity to psa:PST_1852)

Predicted SEED Role

"Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)" (EC 1.3.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.-.-

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNU5 at UniProt or InterPro

Protein Sequence (137 amino acids)

>Psest_2513 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MPLLKLLHFAALLCWCGSLLYLPAMIAAGTKRSDQLFYRDHAHLTRMVFTLISTPAALIA
IGSGTALFLRDGTLAGWLIMKLTMVTGMALCHALCGVLVLRIEREPERGVTYQCMALGVL
VPVLIALTLWLVLAKPF