Protein Info for Psest_2511 in Pseudomonas stutzeri RCH2

Annotation: molybdenum cofactor biosynthesis protein A, bacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 6 to 331 (326 residues), 377.4 bits, see alignment E=2.8e-117 PF04055: Radical_SAM" amino acids 20 to 180 (161 residues), 123.9 bits, see alignment E=1.2e-39 PF13353: Fer4_12" amino acids 23 to 124 (102 residues), 23.7 bits, see alignment E=7.9e-09 PF06463: Mob_synth_C" amino acids 186 to 314 (129 residues), 133.2 bits, see alignment E=8.4e-43

Best Hits

Swiss-Prot: 81% identical to MOAA_PSEMY: GTP 3',8-cyclase (moaA) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 97% identity to psa:PST_1854)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJX7 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Psest_2511 molybdenum cofactor biosynthesis protein A, bacterial (Pseudomonas stutzeri RCH2)
MPDSQLVDPFGRRITYLRLSVTDRCDFRCTYCMSEDMVFAPRAQILTLEELYAVADAFIS
LGVKRIRVTGGEPLVRKGLTGLLERLGAREELEDLAITTNGSQLPSLAPALHAAGVKRLN
ISLDSLKRDRFAELTRRDRLDQVLEGIEAARRAGFKRIKLNSVVQKGRNDDEILDLVDFA
IERGLDISFIEEMPLGSVSSHQRQITFCSSDEVRERIEARHTLVRSSHATGGPSRYWQVA
GSETQIGFISPHSNNFCGSCNRVRVTAEGKLVLCLGHEGALDLKSLMRRHPGDSERLRNA
LVNALQLKPEKHHFRTDEQVQVVRFMSMTGG