Protein Info for HP15_2405 in Marinobacter adhaerens HP15

Annotation: 3'(2'), 5'-bisphosphate nucleotidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 46% identical to CYSQ_SALTY: 3'(2'),5'-bisphosphate nucleotidase CysQ (cysQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03677, CysQ protein (inferred from 83% identity to maq:Maqu_2651)

Predicted SEED Role

"3'(2'),5'-bisphosphate nucleotidase (EC 3.1.3.7)" (EC 3.1.3.7)

KEGG Metabolic Maps

Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PH66 at UniProt or InterPro

Protein Sequence (258 amino acids)

>HP15_2405 3'(2'), 5'-bisphosphate nucleotidase (Marinobacter adhaerens HP15)
MHYSSILPDVIKVADAASEKVLHIYQSDFKVSYKADASPITAADTAAHDIITHGLRSISR
DIPILSEEGSDIPWEERKHWRRFWLVDPVDGTKDFTQRTGEFTVNIAMIEDGQPVMGVVI
APALKEAFWGIVGEGAHMRDRTGRVHHIRVAEPKPLKRVVASKNHLNEETRAFIEALGDH
ELVQAGSSLKLCRIAEGHADIYPRLGPTSEWDTGAAQAVLMAAGGKVQTLDGEPLKYGKQ
NVLNPYFVASGSWYSPRP