Protein Info for Psest_0247 in Pseudomonas stutzeri RCH2

Annotation: NAD-dependent aldehyde dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 14 to 439 (426 residues), 288.3 bits, E=4.7e-90

Best Hits

Swiss-Prot: 74% identical to CALB_PSEAE: Probable coniferyl aldehyde dehydrogenase (calB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00154, coniferyl-aldehyde dehydrogenase [EC: 1.2.1.68] (inferred from 91% identity to psa:PST_3999)

Predicted SEED Role

"Aldehyde dehydrogenase (EC 1.2.1.3); Probable coniferyl aldehyde dehydrogenase (EC 1.2.1.68)" (EC 1.2.1.3, EC 1.2.1.68)

MetaCyc Pathways

• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• phytol degradation (3/4 steps found)
• ethanol degradation III (2/3 steps found)
• hypotaurine degradation (2/3 steps found)
• mitochondrial NADPH production (yeast) (3/5 steps found)
• octane oxidation (3/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (5/8 steps found)
• fatty acid α-oxidation I (plants) (2/4 steps found)
• histamine degradation (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (1/4 steps found)
• ferulate and sinapate biosynthesis (1/4 steps found)
• putrescine degradation III (1/4 steps found)
• serotonin degradation (3/7 steps found)
• dopamine degradation (1/5 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• alkane oxidation (1/6 steps found)
• limonene degradation IV (anaerobic) (1/7 steps found)
• aromatic biogenic amine degradation (bacteria) (1/8 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Arginine and proline metabolism
• Ascorbate and aldarate metabolism
• Butanoate metabolism
• Fatty acid metabolism
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Histidine metabolism
• Limonene and pinene degradation
• Lysine degradation
• Phenylpropanoid biosynthesis
• Propanoate metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups
• Valine, leucine and isoleucine degradation
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.3

Use Curated BLAST to search for 1.2.1.3 or 1.2.1.68

Sequence Analysis Tools

See L0GDN4 at UniProt or InterPro

Protein Sequence (470 amino acids)

>Psest_0247 NAD-dependent aldehyde dehydrogenases (Pseudomonas stutzeri RCH2)
MSADIPQALATMEALFQRQRSAFLAAPMPSEEDRVRGLDALRDVLATHQPALIEAISADF
GHRSADETLLAEIMPSLHGIRYACRHLRRWMKPSRRRVGLAFQPASARVVYQPLGVVGII
VPWNYPLYLAIGPLIGALAAGNRVMLKMSESTPATGQLLRALLAQIFPEEQVAVVLGDVE
VGRAFARLPFDHLLFTGATHIGRDVMRAAAENLTPVTLELGGKSPAIVSASVPLTDAAER
IAFGKCMNAGQTCVAPDYVLVPQARIEGFVTAYREAVQRQYPSLADNPDYSSIINDRQLA
RLQDYLDDAQAKGARIMPLFAEAQQRRMPHCLLLEVNEHMRVMHEEIFGPLLPVVPYGDL
DEALAYVNARPRPLALYYFGYDRAEQQRVLDKTHSGGVCLNDTLLHVAQDDLPFGGIGPS
GMGQYHGREGFLTFSKAKSLFIKQRFNAARLIYPPYGRWWQKLIYALFIR