Protein Info for PGA1_c02580 in Phaeobacter inhibens DSM 17395

Annotation: putative HTH-type transcriptional regulator pcaQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR02424: pca operon transcription factor PcaQ" amino acids 6 to 304 (299 residues), 404 bits, see alignment E=1.6e-125 PF00126: HTH_1" amino acids 9 to 68 (60 residues), 69.6 bits, see alignment E=1.7e-23 PF03466: LysR_substrate" amino acids 97 to 304 (208 residues), 122.6 bits, see alignment E=1.6e-39

Best Hits

KEGG orthology group: K02623, LysR family transcriptional regulator, pca operon transcriptional activator (inferred from 46% identity to rhi:NGR_b21250)

Predicted SEED Role

"LysR family transcriptional regulator YdcI" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETJ0 at UniProt or InterPro

Protein Sequence (305 amino acids)

>PGA1_c02580 putative HTH-type transcriptional regulator pcaQ (Phaeobacter inhibens DSM 17395)
MRLSSQLKLRHLEVFVEVARKMSVTQAAERLGMTQPAVTRALRELEAVCEKPLVEKHGRG
IRLSAYGEMFRDYAGRSLALTRDGVEMLRGLDAAEGSKVTIGALPTVSATVVPEALASIW
EQGGRNRFSVMSGDNQYLLDLLRRGELDVVVGRLPAPENMVGLDFDPLFRERVTVVVAPD
HPLTRLDAAQLPDALFGKYPVLMPPPASIIRSSVERMFLEQGIPMPDAAIETVSSTFGRQ
FTLAHQAIWVISHGVVRSDLASGVLVALPLDTDSTRGPVGLCLRSEHRLSPAAARFCAAL
KNVCS