Protein Info for PGA1_c24870 in Phaeobacter inhibens DSM 17395

Annotation: phosphoribosylaminoimidazole carboxylase ATPase subunit PurK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 TIGR01161: phosphoribosylaminoimidazole carboxylase, ATPase subunit" amino acids 15 to 359 (345 residues), 389.7 bits, see alignment E=7.8e-121 PF02222: ATP-grasp" amino acids 118 to 287 (170 residues), 187.8 bits, see alignment E=1.2e-59 PF17769: PurK_C" amino acids 314 to 359 (46 residues), 53.3 bits, see alignment 1.8e-18

Best Hits

Swiss-Prot: 58% identical to PURK_BRUME: N5-carboxyaminoimidazole ribonucleotide synthase (purK) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K01589, 5-(carboxyamino)imidazole ribonucleotide synthase [EC: 6.3.4.18] (inferred from 81% identity to sil:SPO0892)

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 6.3.4.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DSW8 at UniProt or InterPro

Protein Sequence (362 amino acids)

>PGA1_c24870 phosphoribosylaminoimidazole carboxylase ATPase subunit PurK (Phaeobacter inhibens DSM 17395)
MTDLSENALKPGAIIGILGGGQLGRMLSVAASRLGFRTHIFEPSATPPAAHVADRITTAS
YEDAEALAAFAAAVDVITYEFENIPTSALDLLETLKPIRPGREALRISQDRLTEKTFLQN
LGLQTAAFSDISDEASLDAALTQIGAPSILKTRRFGYDGKGQARIKTPDDAAEALAAMAG
APSILEGFVNFSHEVSVIAARGVSGEIACFDPGENIHRDGILHTTTVPARLSAGQRMDAV
LMAGKILNALEYVGVLGVELFVTPQGLIVNEIAPRVHNSGHWTQNGCAIDQFEQHIRAVA
GWSLGDGQRHSDVVMENLIGADMDRVPELAREPNTALHLYGKAEAKPGRKMGHVNRVQKP
QT