Protein Info for HP15_2393 in Marinobacter adhaerens HP15

Annotation: sialic acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03586: pseudaminic acid synthase
  • amino acids 19 to 344 (326 residues), 497.2 bits, E=1e-153
• PF03102: NeuB
  • amino acids 39 to 277 (239 residues), 298.4 bits, E=3.9e-93
• PF08666: SAF
  • amino acids 292 to 349 (58 residues), 35.9 bits, E=8.8e-13

Best Hits

KEGG orthology group: K01654, N-acetylneuraminate synthase [EC: 2.5.1.56] (inferred from 75% identity to aeh:Mlg_2327)

Predicted SEED Role

"N-acetylneuraminate synthase (EC 2.5.1.56)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.5.1.56)

MetaCyc Pathways

• CMP-N-acetylneuraminate biosynthesis II (bacteria) (3/3 steps found)
• superpathway of CMP-sialic acids biosynthesis (3/15 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.56

Sequence Analysis Tools

See E4PH54 at UniProt or InterPro

Protein Sequence (350 amino acids)

>HP15_2393 sialic acid synthase (Marinobacter adhaerens HP15)
MTEPKIVIAGREISRNQSPYIIAELSANHNGNLETAMRIISEAVKAGADAVKLQTYRPDT
ITLDCQSDEFKIKGGLWDGRTLYELYEEAHMPWEWHKPLFDHARNVGIPIFSSPFDRTAV
DLLEDLNAPAYKIASFEAIDLPLIRYVAATGKPMIISTGMANAEEIEEAINAAHEGGCKE
LAILHCVSGYPAPAEDYNLRTITDMVERFGLVTGLSDHTLDNTTAIASVVLGASLIEKHF
TLDRRGGGPDDSFSLEPKDLAELCSGAKTAWKSLGKVDYGQKSSEVGNAQFRRSLYFVED
LKCGDRIASSSIRSVRPGYGLPPKYYDELLDRRLKSDVKKGTAVTWDLLA